| Sku |
AAP88042 |
| Price |
99 |
| Name |
DRD3 Peptide - N-terminal region (AAP88042) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
DRD3 |
| Alias symbols |
D3DR, ETM1, FET1 |
| Gene id |
1814 |
| Description of target |
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD). |
| Swissprot id |
P35462-3 |
| Protein accession num |
NP_000787.2 |
| Nucleotide accession num |
NM_000796.5 |
| Protein size |
367 amino acids |
| Molecular weight |
40 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: SSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKE |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- DRD3 Antibody (ARP88042_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
