| Sku |
AAP87125 |
| Price |
99 |
| Name |
TP73 Peptide - C-terminal region (AAP87125) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TP73 |
| Alias symbols |
P73 |
| Gene id |
7161 |
| Description of target |
This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. |
| Swissprot id |
O15350-11 |
| Protein accession num |
NP_001119712.1 |
| Nucleotide accession num |
NM_001126240.2 |
| Protein size |
565 amino acids |
| Molecular weight |
62 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: NAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGF |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- TP73 Antibody (ARP87125_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
