| Sku |
AAP87103 |
| Price |
99 |
| Name |
RHOC Peptide - middle region (AAP87103) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RHOC |
| Alias symbols |
H9, ARH9, ARHC, RHOH9 |
| Gene id |
389 |
| Description of target |
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Swissprot id |
P08134 |
| Protein accession num |
NP_001036143.1 |
| Nucleotide accession num |
NM_001042678.1 |
| Protein size |
193 amino acids |
| Molecular weight |
21 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: LVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKT |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- RHOC Antibody (ARP87103_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
