| Sku |
AAP87047 |
| Price |
99 |
| Name |
RRM2 Peptide - C-terminal region (AAP87047) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RRM2 |
| Alias symbols |
R2, RR2, RR2M |
| Gene id |
6241 |
| Description of target |
This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. |
| Swissprot id |
P31350 |
| Protein accession num |
NP_001025.1 |
| Nucleotide accession num |
NM_001034.3 |
| Protein size |
389 amino acids |
| Molecular weight |
42 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: QYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQR |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- RRM2 Antibody (ARP87047_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
