Sku |
AAP86959 |
Price |
99 |
Name |
XRCC6 Peptide - N-terminal region (AAP86959) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
XRCC6 |
Alias symbols |
ML8, KU70, TLAA, CTC75, CTCBF, G22P1 |
Gene id |
2547 |
Description of target |
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. |
Swissprot id |
P12956 |
Protein accession num |
NP_001275905.1 |
Nucleotide accession num |
NM_001288976.1 |
Protein size |
609 amino acids |
Molecular weight |
70 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: SSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQ |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- XRCC6 Antibody (ARP86959_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |