BECN1 Peptide - N-terminal region (AAP86768)

Data Sheet
 
Sku AAP86768
Price 99
Name BECN1 Peptide - N-terminal region (AAP86768)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene symbol BECN1
Alias symbols ATG6, VPS30, beclin1
Gene id 8678
Description of target This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
Swissprot id Q14457
Protein accession num NP_001300927.1
Nucleotide accession num NM_001313998.1
Protein size 450 amino acids
Molecular weight 52 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: TTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSF
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- BECN1 Antibody (ARP86768_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com