Sku |
AAP85802 |
Price |
99 |
Name |
FASTK Peptide - C-terminal region (AAP85802) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
FASTK |
Alias symbols |
FAST |
Gene id |
10922 |
Description of target |
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. |
Swissprot id |
Q14296-3 |
Protein accession num |
NP_001245390.1 |
Nucleotide accession num |
NM_001258461.1 |
Protein size |
522 amino acids |
Molecular weight |
57 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: VLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGL |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- FASTK Antibody (ARP85802_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |