Sku |
AAP85243 |
Price |
99 |
Name |
SLCO4A1 Peptide - middle region (AAP85243) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SLCO4A1 |
Alias symbols |
POAT, OATP1, OATPE, OATP-E, OATP4A1, OATPRP1, SLC21A12 |
Gene id |
28231 |
Description of target |
Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate. |
Swissprot id |
Q96BD0 |
Protein accession num |
NP_057438.3 |
Nucleotide accession num |
NM_016354.3 |
Protein size |
722 amino acids |
Molecular weight |
79 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: WWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGE |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- SLCO4A1 Antibody (ARP85243_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |