SNX2 Peptide - middle region (AAP84992)

Data Sheet
 
Sku AAP84992
Price 99
Name SNX2 Peptide - middle region (AAP84992)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SNX2
Alias symbols TRG-9
Gene id 6643
Description of target This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may form oligomeric complexes with other family members. Alternate splicing results in multiple transcript variants of this gene. Pseudogenes associated with this gene are located on chromosomes 1 and 7.
Swissprot id O60749-2
Protein accession num NP_001265128.1
Nucleotide accession num NM_001278199.1
Protein size 402 amino acids
Molecular weight 44 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SNX2 Antibody (ARP84992_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com