| Sku |
AAP84486 |
| Price |
99 |
| Name |
ADSL Peptide - middle region (AAP84486) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ADSL |
| Alias symbols |
ASL, AMPS, ASASE |
| Gene id |
158 |
| Description of target |
The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene. |
| Swissprot id |
P30566 |
| Protein accession num |
NP_000017.1 |
| Nucleotide accession num |
NM_000026.2 |
| Protein size |
484 amino acids |
| Molecular weight |
53 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- ADSL Antibody (ARP84486_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
