| Sku |
AAP83852 |
| Price |
99 |
| Name |
MOG Peptide - middle region (AAP83852) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MOG |
| Alias symbols |
BTN6, BTNL11, MOGIG2, NRCLP7 |
| Gene id |
4340 |
| Description of target |
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Swissprot id |
Q16653-3 |
| Protein accession num |
NP_001008229.1 |
| Nucleotide accession num |
NM_001008228.2 |
| Protein size |
208 amino acids |
| Molecular weight |
25 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: VELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRT |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- MOG Antibody (ARP83852_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
