PNMA2 Peptide - C-terminal region (AAP83002)

Data Sheet
 
Sku AAP83002
Price 99
Name PNMA2 Peptide - C-terminal region (AAP83002)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PNMA2
Alias symbols MA2, MM2, RGAG2
Gene id 10687
Description of target Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders.
Swissprot id Q9UL42
Protein accession num NP_009188.1
Nucleotide accession num NM_007257.5
Protein size 364 amino acids
Molecular weight 42 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: LKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGDD
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- PNMA2 Antibody (ARP83002_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com