| Sku |
AAP82142 |
| Price |
99 |
| Name |
IMPA2 Peptide - C-terminal region (AAP82142) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
IMPA2 |
| Gene id |
3613 |
| Description of target |
This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. |
| Swissprot id |
O14732 |
| Protein accession num |
NP_055029.1 |
| Nucleotide accession num |
NM_014214.2 |
| Protein size |
288 amino acids |
| Molecular weight |
31 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: IREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- IMPA2 Antibody (ARP82142_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
