| Sku |
AAP81311 |
| Price |
99 |
| Name |
RASSF2 Peptide - middle region (AAP81311) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RASSF2 |
| Alias symbols |
CENP-34, RASFADIN |
| Gene id |
9770 |
| Description of target |
This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. |
| Swissprot id |
P50749 |
| Protein accession num |
NP_055552.1 |
| Nucleotide accession num |
NM_014737.2 |
| Protein size |
326 amino acids |
| Molecular weight |
38 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- RASSF2 Antibody (ARP81311_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
