Sku |
AAP80880 |
Price |
99 |
Name |
MFGE8 Peptide - middle region (AAP80880) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
MFGE8 |
Alias symbols |
BA46, HMFG, MFGM, SED1, hP47, EDIL1, MFG-E8, SPAG10, OAcGD3S, HsT19888 |
Gene id |
4240 |
Description of target |
This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. |
Swissprot id |
Q08431-2 |
Protein accession num |
NP_001108086.1 |
Nucleotide accession num |
NM_001114614.2 |
Protein size |
312 amino acids |
Molecular weight |
35 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: KEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPG |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- MFGE8 Antibody (ARP80880_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |