Sku |
AAP79173 |
Price |
99 |
Name |
C2 Peptide - middle region (AAP79173) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
C2 |
Alias symbols |
CO2, ARMD14 |
Gene id |
717 |
Description of target |
Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined. |
Swissprot id |
A0A0G2JK28 |
Protein accession num |
NP_000054.2 |
Protein size |
353 amino acids |
Molecular weight |
38 kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti-C2 Antibody (ARP79173_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |