| Sku |
AAP78509 |
| Price |
99 |
| Name |
RCN2 Peptide - middle region (AAP78509) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RCN2 |
| Alias symbols |
E6BP, ERC55, ERC-55, TCBP49 |
| Gene id |
5955 |
| Description of target |
The protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
Q14257 |
| Protein accession num |
NP_001258766.1 |
| Nucleotide accession num |
NM_001271837.1 |
| Protein size |
317 amino acids |
| Molecular weight |
35 kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: RVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFE |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-RCN2 Antibody (ARP78509_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
