ALDH1A3 Peptide - middle region (AAP78297)

Data Sheet
 
Sku AAP78297
Price 99
Name ALDH1A3 Peptide - middle region (AAP78297)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ALDH1A3
Alias symbols ALDH6, MCOP8, RALDH3, ALDH1A6
Gene id 220
Description of target This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants.
Swissprot id P47895
Protein accession num NP_000684.2
Nucleotide accession num NM_000693.3
Protein size 512 amino acids
Molecular weight 56 kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ALDH1A3 Antibody (ARP78297_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com