Sku |
AAP78297 |
Price |
99 |
Name |
ALDH1A3 Peptide - middle region (AAP78297) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
ALDH1A3 |
Alias symbols |
ALDH6, MCOP8, RALDH3, ALDH1A6 |
Gene id |
220 |
Description of target |
This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants. |
Swissprot id |
P47895 |
Protein accession num |
NP_000684.2 |
Nucleotide accession num |
NM_000693.3 |
Protein size |
512 amino acids |
Molecular weight |
56 kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-ALDH1A3 Antibody (ARP78297_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |