| Sku |
AAP76074 |
| Price |
99 |
| Name |
CYP11B2 Peptide - N-terminal region (AAP76074) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CYP11B2 |
| Alias symbols |
CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo, |
| Gene id |
1585 |
| Description of target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has steroid 18-hydroxylase activity to synthesize aldosterone and 18-oxocortisol as well as steroid 11 beta-hydroxylase activity. Mutations in this gene cause corticosterone methyl oxidase deficiency. |
| Swissprot id |
P19099 |
| Protein accession num |
NP_000489.3 |
| Nucleotide accession num |
NM_000498.3 |
| Protein size |
167 amino acids |
| Molecular weight |
58 kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: FEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPR |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
