Sku |
AAP75699 |
Price |
99 |
Name |
PAK6 Peptide - N-terminal region (AAP75699) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
PAK6 |
Alias symbols |
PAK6,PAK5, |
Gene id |
56924 |
Description of target |
This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants. |
Swissprot id |
Q9NQU5 |
Protein accession num |
NP_064553 |
Protein size |
681 amino acids |
Molecular weight |
74kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRR |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti-PAK6 Antibody (ARP75699_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |