PDCD6IP Peptide - C-terminal region (AAP75320)

Data Sheet
 
Sku AAP75320
Price 99
Name PDCD6IP Peptide - C-terminal region (AAP75320)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PDCD6IP
Alias symbols AIP1, ALIX, HP95, DRIP4
Gene id 10015
Description of target This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Swissprot id Q8WUM4
Protein accession num NP_037506
Protein size 868 amino acids
Molecular weight 95kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS
Partner proteins UBI4; CEP55; UBC; SUMO2; nef; EZH2; IPO9; UBA6; MCTS1; AHCYL1; EZR; UBA1; MAPK1; CHMP4B; gag; UBD; BAG3; RNF11; KEAP1; VCAM1; SH3GL1; CHMP4C; TNIP2; ITGA4; CXCR1; GRB2; HOXA1; PEF1; VPS4B; ABCC1; GPI; PDCD6; F2R; CUL3; ALG2; PTK2B; TUBB; SIRT7; SH3KBP1; C
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-PDC6I Antibody (ARP75320_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com