| Sku |
AAP75225 |
| Price |
99 |
| Name |
MTMR2 Peptide - C-terminal region (AAP75225) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MTMR2 |
| Alias symbols |
MTMR2,KIAA1073, |
| Gene id |
8898 |
| Description of target |
This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. |
| Swissprot id |
Q13614 |
| Protein size |
643 amino acids |
| Molecular weight |
70kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: RHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISN |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MTMR2 Antibody (ARP75225_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
