GAD2 Peptide - N-terminal region (AAP74935)

Data Sheet
 
Sku AAP74935
Price $99
Name GAD2 Peptide - N-terminal region (AAP74935)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GAD2
Alias symbols GAD65
Gene id 2572
Description of target This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
Swissprot id Q05329
Protein accession num NP_001127838
Protein size 585 amino acids
Molecular weight 64kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
Partner proteins CMTM5; MAL2; TMEM159; AGTRAP; ARL6IP1; GAD1; F10; PRKCE; PRKACA; ZDHHC17;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-DCE2 Antibody (ARP74935_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com