Sku |
AAP74570 |
Price |
99 |
Name |
HOXB2 Peptide - middle region (AAP74570) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
HOXB2 |
Alias symbols |
K8, HOX2, HOX2H, Hox-2.8 |
Gene id |
3212 |
Description of target |
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer. |
Swissprot id |
P14652 |
Protein accession num |
NP_002136.1 |
Nucleotide accession num |
NM_002145.3 |
Protein size |
356 amino acids |
Molecular weight |
39 kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: QVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGP |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-HOXB2 Antibody (ARP74570_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |