HOXB2 Peptide - middle region (AAP74570)

Data Sheet
 
Sku AAP74570
Price 99
Name HOXB2 Peptide - middle region (AAP74570)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene HOXB2
Alias symbols K8, HOX2, HOX2H, Hox-2.8
Gene id 3212
Description of target This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.
Swissprot id P14652
Protein accession num NP_002136.1
Nucleotide accession num NM_002145.3
Protein size 356 amino acids
Molecular weight 39 kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: QVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGP
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-HOXB2 Antibody (ARP74570_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com