RUNX3 Peptide - C-terminal region (AAP74196)

Data Sheet
 
Sku AAP74196
Price 99
Name RUNX3 Peptide - C-terminal region (AAP74196)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene RUNX3
Alias symbols RUNX3,AML2, CBFA3, PEBP2A3,
Gene id 864
Description of target This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot id Q13761
Protein size 415 amino acids
Molecular weight 45kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCT
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-RUNX3 Antibody (ARP74196_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com