| Sku |
AAP74191 |
| Price |
$99.00 |
| Name |
RPS19 Peptide - C-terminal region (AAP74191) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RPS19 |
| Alias symbols |
DBA, S19, DBA1, eS19 |
| Gene id |
6223 |
| Description of target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19E family of ribosomal proteins. It is located in the cytoplasm. Mutations in this gene cause Diamond-Blackfan anemia (DBA), a constitutional erythroblastopenia characterized by absent or decreased erythroid precursors, in a subset of patients. This suggests a possible extra-ribosomal function for this gene in erythropoietic differentiation and proliferation, in addition to its ribosomal function. Higher expression levels of this gene in some primary colon carcinomas compared to matched normal colon tissues has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Swissprot id |
P39019 |
| Protein accession num |
NP_001013 |
| Protein size |
145 amino acids |
| Molecular weight |
15kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH |
| Partner proteins |
TP53; HUWE1; CEP250; NEDD1; TUBGCP4; TUBGCP2; PPP2R1A; AURKA; UBC; MDM2; RPS17; RNF2; WIBG; EIF2A; TSR1; SERBP1; EIF3E; FAU; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS20; RPS18; RPS16; RPS15A; RPS15; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-RS19 Antibody (ARP74191_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
