| Sku |
AAP74151 |
| Price |
99 |
| Name |
PRPF4 Peptide - middle region (AAP74151) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
PRPF4 |
| Alias symbols |
PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60 |
| Gene id |
9128 |
| Description of target |
The protein encoded by this gene is part of a heteromeric complex that binds U4, U5, and U6 small nuclear RNAs and is involved in pre-mRNA splicing. The encoded protein also is a mitotic checkpoint protein and a regulator of chemoresistance in human ovarian cancer. Two transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
O43172 |
| Protein accession num |
NP_004688.2 |
| Nucleotide accession num |
NM_001244926.1 |
| Protein size |
522 amino acids |
| Molecular weight |
57 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: RERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARL |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- PRPF4 Antibody (ARP74151_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
