| Sku |
AAP74027 |
| Price |
$99.00 |
| Name |
LDB1 Peptide - C-terminal region (AAP74027) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
LDB1 |
| Alias symbols |
LDB1,CLIM2, |
| Gene id |
8861 |
| Description of target |
LDB1 binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. It may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. It acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. |
| Swissprot id |
Q86U70 |
| Protein size |
411 amino acids |
| Molecular weight |
45kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-LDB1 Antibody (ARP74027_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
