Sku |
AAP73859 |
Price |
$99.00 |
Name |
FHIT Peptide - C-terminal region (AAP73859) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
FHIT |
Alias symbols |
FHIT, |
Gene id |
2272 |
Description of target |
This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene. |
Swissprot id |
P49789 |
Protein accession num |
XP_005265010 |
Protein size |
147 amino acids |
Molecular weight |
16kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-FHIT Antibody (ARP73859_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |