ACKR1 Peptide - N-terminal region (AAP73814)

Data Sheet
 
Sku AAP73814
Price $99.00
Name ACKR1 Peptide - N-terminal region (AAP73814)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ACKR1
Alias symbols FY, Dfy, GPD, DARC, GpFy, CCBP1, CD234, WBCQ1, DARC/ACKR1
Gene id 2532
Description of target The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot id Q16570
Protein accession num NP_002027
Protein size 336 amino acids
Molecular weight 36kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: LSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDD
Partner proteins CXCL5; CCL8; CCL17; CCL5; CCL7; CCL2; CXCL1; CXCL8;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-DARC Antibody (ARP73814_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com