| Sku |
AAP70964 |
| Price |
$99.00 |
| Name |
NSMCE4A Peptide - C-terminal region (AAP70964) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NSMCE4A |
| Alias symbols |
C10orf86, NS4EA, NSE4A |
| Gene id |
54780 |
| Description of target |
NSMCE4A is a component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). It is involved in positive regulation of response to DNA damage stimulus. |
| Protein accession num |
NP_001161337 |
| Nucleotide accession num |
NM_001167865 |
| Protein size |
384 amino acids |
| Molecular weight |
42kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NSMCE4A Antibody (ARP70964_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
