METTL17 Peptide - C-terminal region (AAP70850)

Data Sheet
 
Sku AAP70850
Price $99.00
Name METTL17 Peptide - C-terminal region (AAP70850)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene METTL17
Alias symbols METT11D1
Gene id 64745
Description of target METTL17 may be a component of the mitochondrial small ribosomal subunit.
Swissprot id Q9H7H0
Protein accession num NP_073571
Nucleotide accession num NM_022734
Protein size 456 amino acids
Molecular weight 48kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: GVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLV
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-METTL17 Antibody (ARP70850_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com