C10orf90 Peptide - C-terminal region (AAP68080)

Data Sheet
 
Sku AAP68080
Price $99.00
Name C10orf90 Peptide - C-terminal region (AAP68080)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene C10orf90
Alias symbols FATS, bA422P15.2
Gene id 118611
Description of target C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
Swissprot id Q96M02
Protein accession num NP_001004298
Nucleotide accession num NM_001004298
Protein size 699 amino acids
Molecular weight 77kDa
Species reactivity Human
Application WB
Peptide sequence QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-C10orf90 Antibody (ARP68080_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com