| Sku |
AAP67762 |
| Price |
$99.00 |
| Name |
Psmg2 Peptide - middle region (AAP67762) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Psmg2 |
| Alias symbols |
1700017I17Rik, AW545363, Clast3, Tnfsf5ip1 |
| Gene id |
107047 |
| Description of target |
Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. |
| Swissprot id |
Q9EST4 |
| Protein accession num |
NP_598899 |
| Nucleotide accession num |
NM_134138 |
| Protein size |
264 amino acids |
| Molecular weight |
29kDa |
| Species reactivity |
Mouse, Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Psmg2 Antibody (ARP67762_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
