CADM4 Peptide - middle region (AAP66528)

Data Sheet
 
Sku AAP66528
Price $99.00
Name CADM4 Peptide - middle region (AAP66528)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CADM4
Alias symbols IGSF4C, NECL4, Necl-4, TSLL2, synCAM4
Gene id 199731
Description of target CADM4 is involved in the cell-cell adhesion. It has calcium- and magnesium-independent cell-cell adhesion activity. It may have tumor-suppressor activity.
Swissprot id Q8NFZ8
Protein accession num NP_660339
Nucleotide accession num NM_145296
Protein size 388 amino acids
Molecular weight 42kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CADM4 Antibody (ARP66528_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com