Sku |
AAP66528 |
Price |
$99.00 |
Name |
CADM4 Peptide - middle region (AAP66528) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CADM4 |
Alias symbols |
IGSF4C, NECL4, Necl-4, TSLL2, synCAM4 |
Gene id |
199731 |
Description of target |
CADM4 is involved in the cell-cell adhesion. It has calcium- and magnesium-independent cell-cell adhesion activity. It may have tumor-suppressor activity. |
Swissprot id |
Q8NFZ8 |
Protein accession num |
NP_660339 |
Nucleotide accession num |
NM_145296 |
Protein size |
388 amino acids |
Molecular weight |
42kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CADM4 Antibody (ARP66528_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |