LRRTM3 Peptide - middle region (AAP65921)

Data Sheet
 
Sku AAP65921
Price $99.00
Name LRRTM3 Peptide - middle region (AAP65921)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene LRRTM3
Alias symbols LRRTM3, UNQ803/PRO1693,
Gene id 347731
Description of target LRRTM3 exhibits a limited synaptogenic activity in vitro, restricted to excitatory presynaptic differentiation. It may play a role in the development and maintenance of the vertebrate nervous system.
Swissprot id Q86VH5-2
Protein size 513 amino acids
Molecular weight 56kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-LRRTM3 Antibody (ARP65921_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com