| Sku |
AAP64209 |
| Price |
$99.00 |
| Name |
MYO10 Peptide - C-terminal region (AAP64209) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MYO10 |
| Gene id |
4651 |
| Description of target |
This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis. |
| Swissprot id |
Q8NCI3 |
| Protein accession num |
BAC11158 |
| Nucleotide accession num |
NM_012334 |
| Protein size |
984 amino acids |
| Molecular weight |
110kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MYO10 Antibody (ARP64209_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
