| Sku |
AAP64034 |
| Price |
$99.00 |
| Name |
SFTPA2 Peptide - N-terminal region (AAP64034) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SFTPA2 |
| Alias symbols |
COLEC5, FLJ50594, FLJ50597, FLJ51953, FLJ79091, FLJ93678, MGC133169, MGC133366, MGC189714, MGC189761, PSAP, SFTP1, SFTPA2B, SPA2, SPAII |
| Gene id |
729238 |
| Description of target |
This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. |
| Swissprot id |
Q8IWL1 |
| Protein accession num |
NP_001092138 |
| Nucleotide accession num |
NM_001098668 |
| Protein size |
248 amino acids |
| Molecular weight |
26kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL |
| Partner proteins |
CD93,SFTPA1,SFTPA2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SFTPA2 Antibody (ARP64034_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
