| Sku |
AAP63783 |
| Price |
$99.00 |
| Name |
TUBB3 Peptide - C-terminal region (AAP63783) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TUBB3 |
| Alias symbols |
CFEOM3A, MC1R, TUBB4, beta-4, CDCBM |
| Gene id |
10381 |
| Description of target |
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. |
| Swissprot id |
Q13509 |
| Protein accession num |
NP_006077 |
| Nucleotide accession num |
NM_006086 |
| Protein size |
450 amino acids |
| Molecular weight |
50kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK |
| Partner proteins |
ARHGEF7,CAMSAP3,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,LIG1,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,TF,ARHGEF7,DDX39B,EEF1G,GABARAP,HEXDC,INSM1,KHDRBS1,LAPTM4A,MRPL28,PHIP,RILPL2,ROBO1,SEL1L3,SPTSSA,STAU1,TF,UBC |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TUBB3 Antibody (ARP63783_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
