| Sku |
AAP63729 |
| Price |
$99.00 |
| Name |
BEGAIN Peptide - middle region (AAP63729) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
BEGAIN |
| Alias symbols |
KIAA1446 |
| Gene id |
57596 |
| Description of target |
BEGAIN may sustain the structure of the postsynaptic density (PSD). |
| Swissprot id |
Q9BUH8 |
| Protein accession num |
NP_065887 |
| Nucleotide accession num |
NM_020836 |
| Protein size |
593 amino acids |
| Molecular weight |
65kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
AEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQ |
| Partner proteins |
ABLIM1,BAHD1,BEGAIN,C16orf48,C17orf28,CATSPER1,DEF6,DLG1,DLG4,DTNB,FAM107A,GFI1B,HGS,KIAA0408,RBL1,RIBC2,TRIM27,USP2,ZFP64,ZNF250,ZNF417,ABLIM1,BAHD1,BEGAIN,C16orf48,C17orf28,CATSPER1,Cep170,DEF6,DTNB,FAM107A,HGS,Haus1,Haus4,KIAA0408,Ndc80,RBL1,RIBC2,TRIM27,USP2,ZFP64,ZNF250,ZNF417 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-BEGAIN Antibody (ARP63729_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
