BEGAIN Peptide - middle region (AAP63729)

Data Sheet
 
Sku AAP63729
Price $99.00
Name BEGAIN Peptide - middle region (AAP63729)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene BEGAIN
Alias symbols KIAA1446
Gene id 57596
Description of target BEGAIN may sustain the structure of the postsynaptic density (PSD).
Swissprot id Q9BUH8
Protein accession num NP_065887
Nucleotide accession num NM_020836
Protein size 593 amino acids
Molecular weight 65kDa
Species reactivity Human
Application WB
Peptide sequence AEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQ
Partner proteins ABLIM1,BAHD1,BEGAIN,C16orf48,C17orf28,CATSPER1,DEF6,DLG1,DLG4,DTNB,FAM107A,GFI1B,HGS,KIAA0408,RBL1,RIBC2,TRIM27,USP2,ZFP64,ZNF250,ZNF417,ABLIM1,BAHD1,BEGAIN,C16orf48,C17orf28,CATSPER1,Cep170,DEF6,DTNB,FAM107A,HGS,Haus1,Haus4,KIAA0408,Ndc80,RBL1,RIBC2,TRIM27,USP2,ZFP64,ZNF250,ZNF417
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-BEGAIN Antibody (ARP63729_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6350 Nancy Ridge Dr, Suite 106, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com