Sku |
AAP63674 |
Price |
$99.00 |
Name |
PGM2 Peptide - C-terminal region (AAP63674) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
PGM2 |
Alias symbols |
FLJ10983, MSTP006 |
Gene id |
55276 |
Description of target |
PGM2 catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2 may also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM2 has low glucose 1,6-bisphosphate synthase activity. |
Swissprot id |
Q96G03 |
Protein accession num |
NP_060760 |
Nucleotide accession num |
NM_018290 |
Protein size |
612 amino acids |
Molecular weight |
67kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
AIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKI |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-PGM2 Antibody (ARP63674_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |