PGM2 Peptide - C-terminal region (AAP63674)

Data Sheet
 
Sku AAP63674
Price $99.00
Name PGM2 Peptide - C-terminal region (AAP63674)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PGM2
Alias symbols FLJ10983, MSTP006
Gene id 55276
Description of target PGM2 catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2 may also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM2 has low glucose 1,6-bisphosphate synthase activity.
Swissprot id Q96G03
Protein accession num NP_060760
Nucleotide accession num NM_018290
Protein size 612 amino acids
Molecular weight 67kDa
Species reactivity Human
Application WB
Peptide sequence AIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKI
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-PGM2 Antibody (ARP63674_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6350 Nancy Ridge Dr, Suite 106, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com