MDK Peptide - C-terminal region (AAP63426)

Data Sheet
 
Sku AAP63426
Price $99.00
Name MDK Peptide - C-terminal region (AAP63426)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MDK
Alias symbols FLJ27379, MK, NEGF2
Gene id 4192
Description of target Midkine is a retinoic acid-responsive, heparin-binding growth factor expressed in various cell types during embryogenesis. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis.
Swissprot id P21741
Protein accession num NP_002382
Nucleotide accession num NM_002391
Protein size 143 amino acids
Molecular weight 16kDa
Species reactivity Human
Application WB
Peptide sequence CDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Partner proteins ALK,JAK1,JAK2,LRP1,LRP2,MDK,NCL,PTPRZ1,RPL18A,SDC1,SDC3,SDC4,STAT1,TGM1,TSPAN1,UBQLN4,ACTG1,LRP1,NCAM1,NCL,NID1,NID2,PTPRZ1,RPL18A,TUBA1A,TUBB2B
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MDK Antibody (ARP63426_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com