MME Peptide - C-terminal region (AAP63365)

Data Sheet
 
Sku AAP63365
Price $99.00
Name MME Peptide - C-terminal region (AAP63365)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MME
Alias symbols CALLA, CD10, DKFZp686O16152, MGC126681, MGC126707, NEP, SFE
Gene id 4311
Description of target This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5' untranslated region of this gene is alternatively spliced, resulting in four separate mRNA transcripts.
Swissprot id P08473
Protein accession num NP_009218
Nucleotide accession num NM_007287
Protein size 750 amino acids
Molecular weight 83kDa
Species reactivity Human
Application WB
Peptide sequence EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Partner proteins ADCYAP1,ADM,CSNK2B,EDN1,EDN2,GAST,LYN,NDRG1,NPPA,NPPC,PIK3CB,PIK3R1,SHC1,VIP,ALDH3A2,ARL1,ARMC10,ATP12A,ATP5J2,CD4,CDK5RAP3,CLEC4M,CPSF6,CSNK2A1,DNAJB12,EEF1A1,FAAH,FAHD1,FAM83F,FECH,FLOT2,FOLH1,HIST1H2AG,HSPA1A,HSPA4,HSPA8,HSPB1,IMPDH2,INPP5D,IRAK2,ITFG3,KBTBD3,KRT10,LAMTOR1,LMNA,LONP1,LYN,METTL7A,MME,MRPL44,MRPS25,MRVI1,MTDH,MTHFD1,MYH9,NDUFA10,NDUFA9,NDUFB4,NNT,NOLC1,NUCKS1,OPA1,PCNA,PDIA5,POTEI,RAP2B,RBM39,RGPD6,RPL30,RPS10,RPS23,RUVBL1,RUVBL2,SDF4,SLC16A1,SLC9A3R1,SRSF11,SSR4,TM9SF1,TNPO1,TUBB8,UBAC2,UTRN,VDAC2,XRCC5,ZMPSTE24
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MME Antibody (ARP63365_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com