Sku |
AAP63284 |
Price |
$99.00 |
Name |
CD47 Peptide - N-terminal region (AAP63284) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CD47 |
Alias symbols |
IAP, MER6, OA3 |
Gene id |
961 |
Description of target |
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. |
Swissprot id |
Q08722-3 |
Protein accession num |
NP_001768 |
Nucleotide accession num |
NM_001777 |
Protein size |
305 amino acids |
Molecular weight |
31kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
FKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT |
Partner proteins |
THBS1,BNIP3,EPB42,FAS,GNAI1,ITGAV,P2RY2,PTK2,RHAG,SIRPA,THBS1,UBQLN1,BNIP3,ITGB1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CD47 Antibody (ARP63284_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |