Sku |
AAP63000 |
Price |
$99.00 |
Name |
NOS2 Peptide - N-terminal region (AAP63000) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
NOS2 |
Alias symbols |
HEP-NOS, INOS, NOS, NOS2A |
Gene id |
4843 |
Description of target |
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. |
Swissprot id |
P35228 |
Protein accession num |
EAW51048 |
Nucleotide accession num |
NM_000625 |
Protein size |
997 amino acids |
Molecular weight |
110kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS |
Partner proteins |
ACTB,ACTN4,CAV1,NOS2,RAC1,RAC2,SLC9A3R1,SRC,CAV1,RAC1,RAC2,SLC9A3R1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-NOS2 Antibody (ARP63000_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |