NOS2 Peptide - N-terminal region (AAP63000)

Data Sheet
 
Sku AAP63000
Price $99.00
Name NOS2 Peptide - N-terminal region (AAP63000)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene NOS2
Alias symbols HEP-NOS, INOS, NOS, NOS2A
Gene id 4843
Description of target Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
Swissprot id P35228
Protein accession num EAW51048
Nucleotide accession num NM_000625
Protein size 997 amino acids
Molecular weight 110kDa
Species reactivity Human
Application IHC, WB
Peptide sequence PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS
Partner proteins ACTB,ACTN4,CAV1,NOS2,RAC1,RAC2,SLC9A3R1,SRC,CAV1,RAC1,RAC2,SLC9A3R1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-NOS2 Antibody (ARP63000_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com