HLA-E Peptide - C-terminal region (AAP62847)

Data Sheet
 
Sku AAP62847
Price $99.00
Name HLA-E Peptide - C-terminal region (AAP62847)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene HLA-E
Alias symbols DKFZp686P19218, EA1.2, EA2.1, HLA-6.2, MHC, QA1
Gene id 3133
Description of target HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail.
Swissprot id P13747
Protein accession num NP_005507
Nucleotide accession num NM_005516
Protein size 358 amino acids
Molecular weight 38kDa
Species reactivity Human
Application WB
Peptide sequence IPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQG
Partner proteins B2M,CD8A,HLA-E,KLRC1,KLRC2,KLRD1,PPP1R16A,B2M,KLRD1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-HLA-E Antibody (ARP62847_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com