| Sku |
AAP62697 |
| Price |
$99.00 |
| Name |
NUDT2 Peptide - middle region (AAP62697) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NUDT2 |
| Alias symbols |
APAH1, MGC10404 |
| Gene id |
318 |
| Description of target |
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. |
| Swissprot id |
P50583 |
| Protein accession num |
NP_671702 |
| Nucleotide accession num |
NM_147173 |
| Protein size |
147 amino acids |
| Molecular weight |
16kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NUDT2 Antibody (ARP62697_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
