STN1 Peptide - C-terminal region (AAP62578)

Data Sheet
 
Sku AAP62578
Price $99.00
Name STN1 Peptide - C-terminal region (AAP62578)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene STN1
Alias symbols AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2
Gene id 79991
Description of target OBFC1 and C17ORF68 (MIM 613129) are subunits of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase (see MIM 176636), the enzyme that initiates DNA replication (Casteel et al., 2009 [PubMed 19119139]). OBFC1 also appears to function in a telomere-associated complex with C17ORF68 and TEN1 (C17ORF106; MIM 613130) (Miyake et al., 2009 [PubMed 19854130]).[supplied by OMIM, Nov 2009]
Swissprot id Q9H668
Protein accession num NP_079204
Nucleotide accession num NM_024928
Protein size 368 amino acids
Molecular weight 40kDa
Species reactivity Human
Application WB
Peptide sequence DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ
Partner proteins LDLRAP1; TPP1; MVP; APP; UBD; UBC; MED8; MED30; MED25; MED29; MED9; MED4; MED16; MED6; MED13; MED12; MED24; MED27; MED17; MED23; MED14; MED1; POLR2A; RCOR1; TUBGCP4;
Subunit STN1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-OBFC1 Antibody (ARP62578_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com