CCRL1 Peptide - C-terminal region (AAP62100)

Data Sheet
 
Sku AAP62100
Price $99.00
Name CCRL1 Peptide - C-terminal region (AAP62100)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ACKR4
Alias symbols CC-CKR-11, CCBP2, CCR10, CCR11, CCX-CKR, CKR-11, PPR1, VSHK1, CCR-11, CCX CKR, CCRL1
Gene id 51554
Description of target The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.
Swissprot id Q9NPB9
Protein accession num NP_057641
Nucleotide accession num NM_016557
Protein size 350 amino acids
Molecular weight 39kDa
Species reactivity Human
Application WB
Peptide sequence PILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFS
Partner proteins CDK2; CXCL13; CCL21; CCL25; CCL8; CCL19; CCL13; CCL11; CCL5; CCL7; CCL2;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CCRL1 Antibody (ARP62100_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com