SEMA4D Peptide - N-terminal region (AAP61493)

Data Sheet
 
Sku AAP61493
Old sku AAPP47848
Price $99.00
Name SEMA4D Peptide - N-terminal region (AAP61493)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene symbol SEMA4D
Alias symbols C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
Gene id 10507
Description of target SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Swissprot id Q92854-2
Protein accession num NP_001135759
Nucleotide accession num NM_001142287
Protein size 738 amino acids
Molecular weight 81kDa
Species reactivity Human
Application WB
Peptide sequence SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SEMA4D Antibody (ARP61493_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com